PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bathy08g01970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Bathycoccus
Family Dof
Protein Properties Length: 1019aa    MW: 107299 Da    PI: 5.5359
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bathy08g01970genomeORCAEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof89.72.5e-28553609460
         zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                    ++++c+rC+s++t+fCyynn  lsqPr++C+aC+ryWt+GG+ rn+P G+grrk++ 
  Bathy08g01970 553 NHRPCARCNSNETRFCYYNNGLLSQPRHYCRACQRYWTEGGTQRNLPKGSGRRKDRG 609
                    6789**************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.8E-223144No hitNo description
SuperFamilySSF521722.99E-196145IPR011006CheY-like superfamily
SMARTSM004483.9E-186141IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011030.9837145IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.0E-148140IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.24E-179145No hitNo description
PfamPF027013.6E-24553608IPR003851Zinc finger, Dof-type
PROSITE profilePS5088424.279555609IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-19556608IPR003851Zinc finger, Dof-type
PROSITE patternPS013610557593IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1019 aa     Download sequence    Send to blast
MNNASKKILV VDDIGLCRRI TTNQLEQLGF KDSPVATSGK EAIQYIDEKQ GEVQCILLDI  60
MMPQENGVET LAEIRKHEKF RREHLEPGHE EEEPIKVIAV TALKHGELLS LCESTGEAGH  120
SVMFDGYIEK PATLTKIRDA METAAIMFAS SLPSGLDQKT RKINNNNNNN NNNNSTKNLA  180
TLAAPAKVQR GNSDGGSGGS DPITDGGGSG GRGGSNEGTD TRNKGSNEVD NGTSSDEKGQ  240
TQSKGLGGKM SAKAGKEKKQ DQIDKLKKEE EENDDENNKH KRAASPGLGG NKVRPTHSGE  300
TTSAAPEHDL EKYGSNERNV GGGNQSKRAH FNEGDNAAAG NENTDGISNE DATNKKETTV  360
LENVYDKNRS ERRSERSKRN QSQTRHSPSR RGARDMNNTD DDDEGNDTGN EKDTDSGEHQ  420
GSAGGSGKNS EEPNPRGMSP QANSGGSREG SGGSGNDGSG GSGAETTLNI QMPKEGDKDR  480
GGQVKVKIAK DEDVEDEADR NSPDENGDMP MTPATDIIEQ RDAQQQQQQM QPQKTQKELE  540
REQNIAGRED VNNHRPCARC NSNETRFCYY NNGLLSQPRH YCRACQRYWT EGGTQRNLPK  600
GSGRRKDRGA PNVHHASGYG GGDGDGADGR NNTETPAMNA AAGLAGLASA AGNALGGAGP  660
AFLRQPPNIA AAAAVARQQV LLPNSMVGVP STASNGSNQL PFNFPGVSAA QIATAARNAA  720
GGGFGSVGSQ PGANADAAVL AGMHSASNAD AQVAQLLSSV AGYDVNLAAS LVGFAAARVG  780
EEIARNAKMI HGDSPGADIS ERVVTLAKIT GWRIGTAIST IAMSSVEHGM VQADVNTLVQ  840
AQLPIVTSQA TMEANAILQT MSSSTTSEKP QSETENNDNI SGGKKATGSG NSGGSGGTGV  900
DSMGNNVNAQ ATSAPEATIL AMQQAQQAAV ARWMNDLGGA PFMQQQQQQL QQLQQQQQQQ  960
QQLLLLQQQQ QQQQGGKSAQ AAQYASLLMN LTGGEAVDAK ATPKRKTNEV KKSTNNSS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFO0822710.0FO082271.1 Bathycoccus prasinos genomic : Chromosome_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007511560.10.0cycling DOF factor 2
TrEMBLK8EI310.0K8EI31_9CHLO; Cycling DOF factor 2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP46551111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.19e-24cycling DOF factor 1